PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00119.73
Common NameAMTR_s00119p00095480, LOC18425201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 413aa    MW: 45468.8 Da    PI: 7.6364
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00119.73genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.2e-334296155
                                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                             kprl+WtpeLHerFveav+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00119.73 42 KPRLKWTPELHERFVEAVAQLGGADKATPKNVMRVMGIPGLTLYHLKSHLQKYRL 96
                                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.8393999IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-324097IPR009057Homeodomain-like
SuperFamilySSF466897.35E-174197IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-234297IPR006447Myb domain, plants
PfamPF002491.6E-94495IPR001005SANT/Myb domain
PfamPF143791.8E-24142188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MYYQGKNCFS SSRATMPPER PLLLHGANIQ GDPGLVLSTD AKPRLKWTPE LHERFVEAVA  60
QLGGADKATP KNVMRVMGIP GLTLYHLKSH LQKYRLSKNL RSQSNGSDKN GPAAAAERMS  120
HTNGPHMGMA NMAVSGTNKG LQINEALQMH IEVQRRLHEQ LEVQRHLQLR IEAQGKYLQS  180
VLEKAQETLA KQNPGSSGLE ATRAQISELV SQVSAECLNS AFSGLTEAPS LNNQQAQKSH  240
LADCSMDSCL TSCEGPQKDQ ETQNISIGLG YHSNSLLWQK AEREEFRVQR PNHSTGESLK  300
DTKHYSPSPE RKMHLLTSSF GDTINNVRAP GDKGACSTNS DARRKERGFE GACGEPPRKR  360
SVASRTQALD IEQTEVFDRL SNHTAVLDLN AHDENDASSE CKEFDLNGFS WS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006829830.10.0PREDICTED: uncharacterized protein LOC18425201
TrEMBLW1NNF90.0W1NNF9_AMBTC; Uncharacterized protein
STRINGPOPTR_0013s05670.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-112G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]